PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013622270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 212aa    MW: 24162.7 Da    PI: 6.5191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013622270.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding249.2e-08549346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT  Ed+ + +a  +++ g   +W++Ia  ++  +++ ++++++  
   XP_013622270.1  5 QWTRSEDKMFEQALVLFPEGspnRWERIADQLN--KSAGEVREHYEV 49
                     7*******************************8..9********965 PP

2Myb_DNA-binding41.53e-1397141347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++ E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_013622270.1  97 PWSENEHKLFLIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 141
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.246155IPR017930Myb domain
SMARTSM007173.2E-8253IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-12459IPR009057Homeodomain-like
PfamPF002492.3E-6548IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-4651IPR009057Homeodomain-like
CDDcd001673.12E-6651No hitNo description
PROSITE profilePS5129417.73690146IPR017930Myb domain
SuperFamilySSF466891.08E-1592147IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-1693145IPR006447Myb domain, plants
SMARTSM007171.5E-894144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-1096140IPR009057Homeodomain-like
PfamPF002493.7E-1197141IPR001005SANT/Myb domain
CDDcd001671.36E-797142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MASSQWTRSE DKMFEQALVL FPEGSPNRWE RIADQLNKSA GEVREHYEVL VHDVLEIDSG  60
RVHVPDYMDD SAAGWDSAAQ ISFGSKHGEG ERKRGTPWSE NEHKLFLIGL KRYGKGDWRS  120
ISRNVVVTRT PTQVASHAQK YFLRQNSVKK ERKRSSIHDI TTVDTNLAMP GSNMDWTGQQ  180
ESSVQAQQQQ GMSEFGQELT PGGHYEEFGY RM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622270.11e-159PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3AZR11e-159A0A0D3AZR1_BRAOL; Uncharacterized protein
STRINGBra005818.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-124MYB family protein